Antibodies

Jump to Filters
View as table Download
SHARP1 (BHLHE41) Rabbit Polyclonal Antibody
TA333644

USD 539.00

5 Days

Rabbit Polyclonal Anti-BHLHB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-BHLHB3 Antibody: synthetic peptide directed towards the middle region of human BHLHB3. Synthetic peptide located within the following region: YCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTI
SHARP1 (BHLHE41) Rabbit Polyclonal Antibody
TA347598

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-BHLHB3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHLHB3 Antibody: A synthesized peptide derived from human BHLHB3