Antibodies

Jump to Filters
View as table Download
DGKH Rabbit Polyclonal Antibody
TA337746

USD 539.00

5 Days

Rabbit Polyclonal Anti-DGKH Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW
DGKH Rabbit Polyclonal Antibody
TA337747

USD 539.00

5 Days

Rabbit Polyclonal Anti-DGKH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: EPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQT