Antibodies

Jump to Filters
View as table Download
OXA1L Rabbit Polyclonal Antibody
TA339438

USD 539.00

5 Days

Rabbit Polyclonal Anti-OXA1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OXA1L antibody is: synthetic peptide directed towards the C-terminal region of Human OXA1L. Synthetic peptide located within the following region: NAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS