Antibodies

Jump to Filters
View as table Download
ErbB 3 (ERBB3) Rabbit Polyclonal Antibody
TA590106

USD 482.00

In Stock

Rabbit Polyclonal ErbB3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. In vivo generated recombinant protein fragment
ErbB 3 (ERBB3) Rabbit Polyclonal Antibody
TA313843

USD 380.00

In Stock

Rabbit polyclonal anti-HER3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HER3.
ErbB 3 (ERBB3) Rabbit Polyclonal Antibody
AP20237PU-N

USD 465.00

3 Weeks

ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 1250-1300 of Human ErbB-3.
Cyclophilin 40 (PPID) Rabbit Polyclonal Antibody
TA342238

USD 539.00

5 Days

Rabbit polyclonal Anti-PPID Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPID antibody: synthetic peptide directed towards the middle region of human PPID. Synthetic peptide located within the following region: AECGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKN
Cyclophilin 40 (PPID) Goat Polyclonal Antibody
TA302580

USD 520.00

5 Days

Goat Polyclonal Antibody against PPID / CyP-40

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-DENFHYKHDREG, from the internal region of the protein sequence according to NP_005029.1.
ErbB 3 (ERBB3) Goat Polyclonal Antibody
TA303054

USD 520.00

5 Days

Goat Polyclonal Antibody against ERBB3

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-HSRLFPKANAQRT, from the C Terminus of the protein sequence according to NP_001973.2.
ErbB 3 (ERBB3) Rabbit Polyclonal Antibody
TA319323

USD 725.00

In Stock

Rabbit polyclonal anti-HER3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-HER3 whole rabbit serum was prepared by repeated immunizations with a HER3 fusion protein corresponding to amino acids 1283 to 1323 (40 amino acids) at the carboxy-terminus of human HER3.
Cyclophilin 40 (PPID) Rabbit Polyclonal Antibody
TA342237

USD 539.00

5 Days

Rabbit polyclonal Anti-PPID Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPID antibody: synthetic peptide directed towards the N terminal of human PPID. Synthetic peptide located within the following region: CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
Cyclophilin 40 (PPID) (N-term) Rabbit Polyclonal Antibody
AP18156PU-N

USD 580.00

2 Weeks

Cyclophilin 40 (PPID) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human PPID