Antibodies

Jump to Filters
View as table Download
CD40L (CD40LG) (N-term) Rabbit Polyclonal Antibody
AP23309PU-N

USD 560.00

2 Weeks

CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L
CD40L (CD40LG) Rabbit Polyclonal Antibody
TA334291

USD 539.00

5 Days

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN
CD40L (CD40LG) Rabbit Polyclonal Antibody
TA349779

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CD40LG