Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-IL18 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
TA324190 is a possible alternative to TA324189.
Rabbit polyclonal RELA Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA. |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Drosophila) |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal CASP8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Goat Anti-IL18 Antibody
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NPPDNIKDTKSDI, from the internal region of the protein sequence according to NP_001553.1. |
Rabbit Anti-p38 MAPK (Thr180/Tyr182) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr180/Tyr182 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204 |
| Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit Polyclonal Anti-NLRP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NLRP3 |
Rabbit Polyclonal Anti-IL18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL18 antibody: synthetic peptide directed towards the C terminal of human IL18. Synthetic peptide located within the following region: IIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRS |
Rabbit polyclonal IL-1 beta antibody
| Applications | WB |
| Reactivities | Human, Primate, Dog |
| Conjugation | Unconjugated |
| Immunogen | This antibody was prepared by repeated immunizations with recombinant human IL-1β produced in E.coli. The MW of the recombinant 153 aa IL-1β was 17 kDa with the N-terminal amino acid at position alanine 117. This cleavage site is generated by the IL-1β converting enzyme (ICE, capase-1). |
Active filters
Category
- Antibodies
Reactivities
- Human
Applications
- WB
Isotypes
- IgG
Clonalities
- Polyclonal
Pathways
- NOD-like receptor signaling pathway
Citations
- Yes