TRPM4 mouse monoclonal antibody, clone OTI10H5 (formerly 10H5)
Applications | IHC, WB |
Reactivities | Human, Dog, Monkey |
Conjugation | Unconjugated |
TRPM4 mouse monoclonal antibody, clone OTI10H5 (formerly 10H5)
Applications | IHC, WB |
Reactivities | Human, Dog, Monkey |
Conjugation | Unconjugated |
TRPM8 mouse monoclonal antibody,clone OTI7A11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TRPM4 mouse monoclonal antibody, clone OTI10H5 (formerly 10H5)
Applications | IHC, WB |
Reactivities | Human, Dog, Monkey |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-TRPM4 mouse monoclonal antibody, clone OTI14C3 (formerly 14C3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TRPM4 mouse monoclonal antibody, clone OTI14F1 (formerly 14F1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TRPM4 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
TRPV2 mouse monoclonal antibody,clone OTI2G10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-TRPV1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TRPV1 |
TRPM8 mouse monoclonal antibody,clone OTI7A11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Mouse monoclonal anti-TRPC6 antibody
Applications | IHC, WB |
Reactivities | Human, Chimpanzee |
Conjugation | Unconjugated |
Anti-TRPC3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 834-846 amino acids of human transient receptor potential cation channel, subfamily C, member 3 |
Rabbit Polyclonal Anti-MCOLN3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MCOLN3 antibody: synthetic peptide directed towards the middle region of human MCOLN3. Synthetic peptide located within the following region: TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI |
Rabbit Polyclonal Anti-TRPM6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TRPM6 |
Anti-TRPM4 mouse monoclonal antibody, clone OTI14F1 (formerly 14F1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".