Germany
Japan
United Kingdom
China
Antibodies
View as table Download
TRPM8 mouse monoclonal antibody,clone OTI7A11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TRPM4 mouse monoclonal antibody, clone OTI10H5 (formerly 10H5)
| Applications | IHC, WB |
| Reactivities | Human, Dog, Monkey |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TRPV2 mouse monoclonal antibody,clone OTI2G10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-TRPV1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TRPV1 |
TRPM8 mouse monoclonal antibody,clone OTI7A11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-TRPC3 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 834-846 amino acids of human transient receptor potential cation channel, subfamily C, member 3 |
Rabbit Polyclonal Anti-MCOLN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCOLN3 antibody: synthetic peptide directed towards the middle region of human MCOLN3. Synthetic peptide located within the following region: TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI |
Rabbit Polyclonal Anti-TRPM6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TRPM6 |
Anti-TRPM4 mouse monoclonal antibody, clone OTI14F1 (formerly 14F1)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Families
- Ion Channels: Transient receptor potential
Availabilities
- In Stock