Antibodies

Jump to Filters
View as table Download
GAD65 (GAD2) Rabbit Polyclonal Antibody
TA308367

USD 625.00

In Stock

Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329)
Asparagine synthetase (ASNS) Rabbit Polyclonal Antibody
TA349668

USD 380.00

In Stock

Rabbit Polyclonal Anti-ASNS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ASNS
ACY3 Rabbit Polyclonal Antibody
TA322091

USD 380.00

In Stock

Anti-ACY3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
ACY3 Rabbit Polyclonal Antibody
TA322092

USD 380.00

In Stock

Anti-ACY3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
ALDH4A1 Rabbit Polyclonal Antibody
TA323995

USD 380.00

In Stock

Anti-ALDH4A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 4 family, member A1
ALDH4A1 Rabbit Polyclonal Antibody
TA323996

USD 380.00

In Stock

Anti-ALDH4A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 4 family, member A1
ASPA Rabbit Polyclonal Antibody
TA349667

USD 380.00

In Stock

Rabbit Polyclonal Anti-ASPA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ASPA
Aspartate Aminotransferase (GOT1) Rabbit Polyclonal Antibody
TA349690

USD 380.00

In Stock

Rabbit Polyclonal Anti-GOT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GOT1
GOT2 Rabbit Polyclonal Antibody
TA350033

USD 380.00

In Stock

Rabbit Polyclonal Anti-GOT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GOT2
GAD67 (GAD1) Rabbit Polyclonal Antibody
TA350677

USD 380.00

In Stock

Rabbit Polyclonal Anti-GAD1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GAD1
Glutaminase (GLS) Rabbit Polyclonal Antibody
TA351221

USD 380.00

In Stock

Rabbit Polyclonal Anti-GLS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GLS
ALDH4A1 Rabbit Polyclonal Antibody
TA590378

USD 482.00

In Stock

Rabbit Polyclonal ALDH4A1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
Alanine Transaminase (GPT) Rabbit Polyclonal Antibody
TA322631

USD 380.00

In Stock

Anti-GPT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-14 amino acids of Human Alanine aminotransferase 1
Alanine Transaminase (GPT) Rabbit Polyclonal Antibody
TA338150

USD 485.00

In Stock

Rabbit Polyclonal Anti-GPT Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPT antibody: synthetic peptide directed towards the N terminal of human GPT. Synthetic peptide located within the following region: RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT
GAD67 (GAD1) Rabbit Polyclonal Antibody
TA350840

USD 380.00

In Stock

Rabbit Polyclonal Anti-GAD1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GAD1