Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IHC, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Acid Phosphatase isolated and purified from Human seminal plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
PPP4C Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP4C |
Rabbit polyclonal Anti-SET Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT |
Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Acid Phosphatase isolated and purified from Human seminal plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
PP1C gamma (PPP1CC) rabbit polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A KLH conjugated peptide corresponding to the C-terminal region (311-323) of PP1 gamma 1 catalytic subunit. |
PP1C gamma (PPP1CC) sheep polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide conjugated to KLH |
PP2A-alpha (PPP2CA) sheep polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide conjugated to KLH |
PPP6C sheep polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide conjugated to KLH |
Germany
Japan
United Kingdom
China
