Antibodies

Jump to Filters
View as table Download
YY1 Rabbit Polyclonal Antibody
TA365167

USD 380.00

4 Weeks

YY1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human YY1
YY1 Rabbit Polyclonal Antibody
TA385583

USD 380.00

4 Weeks

YY1 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human YY1
YY1 Rabbit Polyclonal Antibody
TA372022

USD 380.00

4 Weeks

YY1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human YY1
YY1 (Center) Rabbit Polyclonal Antibody
AP12240PU-N

USD 580.00

2 Weeks

YY1 (Center) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the center region of human YY1.
YY1 Rabbit Polyclonal Antibody
TA330124

USD 539.00

5 Days

Rabbit Polyclonal Anti-YY1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-YY1 antibody: synthetic peptide directed towards the middle region of human YY1. Synthetic peptide located within the following region: KQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPR
YY1 Rabbit Polyclonal Antibody
TA367785

USD 380.00

4 Weeks

YY1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human YY1