Antibodies

Jump to Filters
View as table Download
NAGA Mouse Monoclonal Antibody [Clone ID: OTI3A4]
TA811320

USD 447.00

In Stock

NAGA mouse monoclonal antibody,clone OTI3A4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
NAGA Mouse Monoclonal Antibody [Clone ID: OTI3A4]
CF811320

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) NAGA mouse monoclonal antibody,clone OTI3A4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
A4GALT Rabbit Polyclonal Antibody
TA350957

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-A4GALT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human A4GALT
NAGA Mouse Monoclonal Antibody [Clone ID: OTI3A4]
TA811320S

USD 200.00

2 Days

NAGA mouse monoclonal antibody,clone OTI3A4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SIAT4A (ST3GAL1) Rabbit Polyclonal Antibody
TA307977

USD 625.00

2 Weeks

Rabbit polyclonal antibody to ST3GAL1 (ST3 beta-galactoside alpha-2,3-sialyltransferase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 195 of SIAT4A (Uniprot ID#Q11201)
HEXB Rabbit Polyclonal Antibody
TA314004

USD 380.00

2 Weeks

Rabbit polyclonal anti-HEXB antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HEXB.
Galactosidase alpha (GLA) (N-term) Rabbit Polyclonal Antibody
AP17424PU-N

USD 580.00

2 Weeks

Galactosidase alpha (GLA) (N-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 90~120 amino acids from the N-terminal region of human GLA
HEXA Rabbit Polyclonal Antibody
TA343107

USD 539.00

5 Days

Rabbit Polyclonal Anti-HEXA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV
ST3GAL2 Rabbit Polyclonal Antibody
TA307912

USD 625.00

5 Days

Rabbit Polyclonal antibody to ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Chicken, Rat, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 68 and 327 of ST3GAL2 (Uniprot ID#Q16842)