Antibodies

View as table Download

PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

Rabbit Polyclonal Anti-GPD2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPD2

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A

Rabbit polyclonal LCAT Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This LCAT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 285-313 amino acids from the Central region of human LCAT.

Anti-AGPAT4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 146-306 amino acids of human 1-acylglycerol-3-phosphate O-acyltransferase 4

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A

PLA2G2D (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 112-138 amino acids from the C-terminal region of human PLA2G2D

PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

AGPAT2 Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PTDSS2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human PTDSS2

GPD2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 605-634 amino acids from the C-terminal region of human GPD2

Rabbit Polyclonal anti-PPAP2A antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV