Antibodies

Jump to Filters
View as table Download
glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Polyclonal Antibody
TA334652

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
GAA Rabbit Polyclonal Antibody
TA334653

USD 539.00

5 Days

Rabbit Polyclonal Anti-GAA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAA antibody: synthetic peptide directed towards the N terminal of human GAA. Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL
GAA (N-term) Rabbit Polyclonal Antibody
AP51752PU-N

USD 580.00

2 Weeks

GAA (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen conjugated synthetic peptide between 173-203 amino acids from the N-terminal region of Human Alpha-glucosidase
glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Monoclonal Antibody [Clone ID: OTIR4H3]
TA592779S

USD 198.00

2 Days

G6PC Rabbit monoclonal antibody,clone OTIR4H3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Monoclonal Antibody [Clone ID: OTIR5G10]
TA592780S

USD 198.00

2 Days

G6PC Rabbit monoclonal antibody,clone OTIR5G10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Monoclonal Antibody [Clone ID: OTIR2H10]
TA592781S

USD 198.00

2 Days

G6PC Rabbit monoclonal antibody,clone OTIR2H10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".