Antibodies

Jump to Filters
View as table Download
TFB2M (C-term) Rabbit Polyclonal Antibody
AP54226PU-N

USD 580.00

2 Weeks

TFB2M (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 368-396 amino acids from the C-terminal region of human TFB2M
TFB2M Rabbit Polyclonal Antibody
TA335483

USD 485.00

5 Days

Rabbit Polyclonal Anti-TFB2M Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TFB2M Antibody: synthetic peptide directed towards the N terminal of human TFB2M. Synthetic peptide located within the following region: ECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNLDGKLRVIHCD