Antibodies

Jump to Filters
View as table Download
ZFX Rabbit Polyclonal Antibody
TA319738

USD 570.00

5 Days

Rabbit Polyclonal ZFX Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ZFX antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ZFX.
ZFX Rabbit Polyclonal Antibody
TA334007

USD 539.00

5 Days

Rabbit Polyclonal Anti-ZFX Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZFX Antibody: synthetic peptide directed towards the middle region of human ZFX. Synthetic peptide located within the following region: KVYIFKADPGEDDLGGTVDIVESEPENDHGVELLDQNSSIRVPREKMVYM