HNF6 mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HNF6 mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNF6 mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
HNF6 mouse monoclonal antibody, clone OTI4F12 (formerly 4F12), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
HNF6 mouse monoclonal antibody, clone OTI4F12 (formerly 4F12), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HNF6 mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-ONECUT1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ONECUT1 antibody: synthetic peptide directed towards the middle region of human ONECUT1. Synthetic peptide located within the following region: ITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA |