Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
Rabbit polyclonal MAPK3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3. |
Rabbit polyclonal DVL1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | This DVL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 442-470 amino acids from the Central region of human DVL1. |
Rabbit polyclonal DVL3 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This DVL3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 530-557 amino acids from the C-terminal region of human DVL3. |
Rabbit Polyclonal antibody to PKC alpha (protein kinase C, alpha)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 250 of PKC alpha (Uniprot ID#P17252) |
Active filters
Applications
- IHC
Isotypes
- IgG
Families
- ES Cell Differentiation/IPS
Pathways
- Melanogenesis