Antibodies

Jump to Filters
View as table Download
B3GNT1 (B3GNT2) Mouse Monoclonal Antibody [Clone ID: OTI3A9]
TA505283

USD 447.00

In Stock

B3GNT2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
B3GNT1 (B3GNT2) Mouse Monoclonal Antibody [Clone ID: OTI3A9]
CF505283

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) B3GNT2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
B3GNT1 (B3GNT2) Mouse Monoclonal Antibody [Clone ID: OTI3A9]
TA505283S

USD 200.00

In Stock

B3GNT2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

FUT4 Mouse Monoclonal Antibody [Clone ID: MC-480]
TA309665

USD 550.00

In Stock

Mouse Monoclonal SSEA1 Antibody (MC-480)

Applications FC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
B3GNT3 Rabbit Polyclonal Antibody
TA308090

USD 625.00

5 Days

Rabbit Polyclonal antibody to B3GNT3 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 122 and 338 of B3GNT3 (Uniprot ID#Q9Y2A9)
B4GALT3 Rabbit Polyclonal Antibody
TA314795

USD 380.00

In Stock

Rabbit polyclonal anti-B4GALT3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human B4GALT3.
B3GALT2 Rabbit Polyclonal Antibody
TA314797

USD 380.00

4 Weeks

Rabbit polyclonal anti-B3GALT2 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human B3GALT2.
B3GALT2 Rabbit Polyclonal Antibody
TA338206

USD 539.00

5 Days

Rabbit Polyclonal Anti-B3galt2 Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-B3galt2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNK
GCNT2 (C-term) Rabbit Polyclonal Antibody
AP51803PU-N

USD 580.00

2 Weeks

GCNT2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen conjugated synthetic peptide between 371-399 amino acids from the C-terminal region of Human GCNT2 / NACGT1