Rabbit polyclonal antibody to Annexin A1 (annexin A1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Feline, Pig, Rabbit, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of Annexin A1 (Uniprot ID#P04083) |
Rabbit Polyclonal Anti-ANXA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA1 antibody: synthetic peptide directed towards the N terminal of human ANXA1. Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD |
ANXA1 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ANXA1 |
Germany
Japan
United Kingdom
China
