Rabbit Polyclonal Anti-TMPRSS11D Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TMPRSS11D |
Rabbit Polyclonal Anti-TMPRSS11D Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TMPRSS11D |
Rabbit Polyclonal Anti-TMPRSS11D Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TMPRSS11D antibody: synthetic peptide directed towards the N terminal of human TMPRSS11D. Synthetic peptide located within the following region: RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA |
Rabbit Polyclonal Anti-TMPRSS11D Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TMPRSS11D antibody: synthetic peptide directed towards the middle region of human TMPRSS11D. Synthetic peptide located within the following region: IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC |