Antibodies

Jump to Filters
View as table Download
C1QC Rabbit Polyclonal Antibody
TA324448

USD 580.00

5 Days

Rabbit polyclonal C1QC Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This C1QC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-120 amino acids from the Central region of human C1QC.
CD40 Rabbit Polyclonal Antibody
TA311665

USD 380.00

4 Weeks

Rabbit polyclonal anti-CD40 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human CD40.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA323618

USD 380.00

In Stock

Anti-TNF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor
CD16 (FCGR3A) Rabbit Polyclonal Antibody
TA350080

USD 380.00

In Stock

Rabbit Polyclonal Anti-FCGR3A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human FCGR3A
CD40 Rabbit Polyclonal Antibody
TA351052

USD 380.00

In Stock

Rabbit Polyclonal Anti-CD40 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CD40
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA313322

USD 380.00

In Stock

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.
CD40L (CD40LG) (N-term) Rabbit Polyclonal Antibody
AP23309PU-N

USD 560.00

2 Weeks

CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA319289

USD 1,795.00

5 Days

Rabbit polyclonal TNF Alpha antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA319290

USD 1,795.00

5 Days

Rabbit polyclonal TNF alpha antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.
C1QC Rabbit Polyclonal Antibody
TA326232

USD 380.00

4 Weeks

Rabbit polyclonal C1QC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human C1QC.
Complement Component 6 (C6) Rabbit Polyclonal Antibody
TA313533

USD 380.00

4 Weeks

Rabbit polyclonal anti-C6 (complement component 6) antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human C6.
Complement factor 8 beta (C8B) Rabbit Polyclonal Antibody
TA334645

USD 539.00

5 Days

Rabbit Polyclonal Anti-C8B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C8B antibody: synthetic peptide directed towards the middle region of human C8B. Synthetic peptide located within the following region: WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA
Complement factor 8 beta (C8B) Rabbit Polyclonal Antibody
TA334646

USD 539.00

5 Days

Rabbit Polyclonal Anti-C8B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C8B antibody: synthetic peptide directed towards the C terminal of human C8B. Synthetic peptide located within the following region: SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTL
C1QB Rabbit Polyclonal Antibody
TA335243

USD 539.00

5 Days

Rabbit Polyclonal Anti-C1QB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1QB antibody: synthetic peptide directed towards the C terminal of human C1QB. Synthetic peptide located within the following region: AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD