Rabbit polyclonal CP Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 547-577 amino acids from the Central region of human CP. |
Rabbit anti-UGT1A1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A1 |
Rabbit anti-HMOX1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HMOX1 |
Rabbit Polyclonal Anti-FTH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FTH1 antibody: synthetic peptide directed towards the middle region of human FTH1. Synthetic peptide located within the following region: NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKM |
beta glucuronidase (GUSB) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Porcine |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 335 - 362 amino acids from the Center region of Human Beta-glucuronidase |
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
Germany
Japan
United Kingdom
China
