Antibodies

Jump to Filters
View as table Download
Protein S (PROS1) Rabbit Polyclonal Antibody
TA321109

USD 380.00

In Stock

Anti-PROS1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 484-666 amino acids of human protein S (alpha)
Protein S (PROS1) Rabbit Polyclonal Antibody
TA321108

USD 380.00

4 Weeks

Anti-PROS1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 484-666 amino acids of human protein S (alpha)
Protein S (PROS1) Rabbit Polyclonal Antibody
TA335142

USD 539.00

5 Days

Rabbit polyclonal Anti-PROS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PROS1 antibody: synthetic peptide directed towards the middle region of human PROS1. Synthetic peptide located within the following region: MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL