Rabbit polyclonal MAPK14 Antibody (Center T180/Y182)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Zebrafish) |
| Conjugation | Unconjugated |
| Immunogen | This MAPK14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 158-192 amino acids from the Central region of human MAPK14. |
Rabbit polyclonal Anti-RAB5A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS |
Germany
Japan
United Kingdom
China
