Antibodies

Jump to Filters
View as table Download
FRA1 (FOSL1) Rabbit Polyclonal Antibody
TA329252

USD 539.00

5 Days

Rabbit Polyclonal anti-FOSL1 antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-FOSL1 antibody: synthetic peptide directed towards the middle region of human FOSL1. Synthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK
FRA1 (FOSL1) Rabbit Polyclonal Antibody
TA321715

USD 380.00

In Stock

Anti-FOSL1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-16 amino acids of Human FOS-like antigen 1