Antibodies

Jump to Filters
View as table Download
ERCC8 Rabbit Polyclonal Antibody
TA329326

USD 539.00

5 Days

Rabbit Polyclonal anti-ERCC8 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the C terminal of human ERCC8. Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG
ERCC8 (Center) Rabbit Polyclonal Antibody
AP51450PU-N

USD 580.00

2 Weeks

ERCC8 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 210-238 amino acids from the Central region of Human ERCC8