Antibodies

Jump to Filters
View as table Download
MMP2 (C-term) Rabbit Polyclonal Antibody
AP23331PU-N

USD 560.00

2 Weeks

MMP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human MMP2
MMP9 Rabbit Polyclonal Antibody
TA326652

USD 570.00

2 Weeks

Rabbit Polyclonal MMP9 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MMP9 antibody was raised against a 16 amino acid peptide near the center of human MMP9.
MMP2 Rabbit Polyclonal Antibody
TA330021

USD 485.00

5 Days

Rabbit Polyclonal Anti-MMP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP2 antibody: synthetic peptide directed towards the C terminal of human MMP2. Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL