MMP2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human MMP2 |
MMP2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human MMP2 |
Rabbit Polyclonal MMP9 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | MMP9 antibody was raised against a 16 amino acid peptide near the center of human MMP9. |
Rabbit Polyclonal Anti-MMP2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MMP2 antibody: synthetic peptide directed towards the C terminal of human MMP2. Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL |