Anti-YWHAQ Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 140-154 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide |
Anti-YWHAQ Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 140-154 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide |
USD 430.00
3 Weeks
USD 315.00
3 Weeks
Rabbit Polyclonal Anti-YWHAQ Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YWHAQ antibody: synthetic peptide directed towards the N terminal of human YWHAQ. Synthetic peptide located within the following region: SVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSIC |
Germany
Japan
United Kingdom
China
