Antibodies

Jump to Filters
View as table Download
Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody
TA349501

USD 380.00

In Stock

Rabbit Polyclonal Anti-ASL Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ASL
ALDH4A1 Rabbit Polyclonal Antibody
TA590378

USD 482.00

In Stock

Rabbit Polyclonal ALDH4A1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
Alanine Transaminase (GPT) Rabbit Polyclonal Antibody
TA322631

USD 380.00

In Stock

Anti-GPT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-14 amino acids of Human Alanine aminotransferase 1
Alanine Transaminase (GPT) Rabbit Polyclonal Antibody
TA338150

USD 485.00

In Stock

Rabbit Polyclonal Anti-GPT Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPT antibody: synthetic peptide directed towards the N terminal of human GPT. Synthetic peptide located within the following region: RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT
GAD67 (GAD1) Rabbit Polyclonal Antibody
TA350840

USD 380.00

In Stock

Rabbit Polyclonal Anti-GAD1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GAD1
ASS1 Rabbit Polyclonal Antibody
TA308171

USD 625.00

In Stock

Rabbit Polyclonal antibody to ASS1 (argininosuccinate synthetase 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 198 of ASS1 (Uniprot ID#P00966)
Aspartate Aminotransferase (GOT1) Goat Polyclonal Antibody
TA318035

USD 555.00

In Stock

Aspartate Aminotransferase Goat Polyclonal (aa157-167) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human, Rat, Gibbon, Hamster, Orang-Utan (Predicted: Monkey, Goat, Pig)
Conjugation Unconjugated
Immunogen Aspartate Aminotransferase antibody was raised against synthetic peptide C-RSYRYWDAEKR from an internal region of human GOT1 (NP_002070.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Hamster, Elephant (100%); Marmoset, Goat, Pig, Lizard (91%); Mouse, Panda, Bat, Bovine, Horse, Opossum, Turkey, Chicken, Platypus, Xenopus, Salmon, Pufferfish, Seq squirt (82%).
Alanine Transaminase (GPT) Rabbit Polyclonal Antibody
TA322630

USD 380.00

In Stock

Anti-GPT Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-14 amino acids of Human glutamic-pyruvate transaminase (alanine aminotransferase)
Alanine Transaminase (GPT) Rabbit Polyclonal Antibody
TA322632

USD 380.00

In Stock

Anti-GPT Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 101-114 amino acids of human glutamic-pyruvate transaminase (alanine aminotransferase)
GLUD1 Goat Polyclonal Antibody
TA316789

USD 500.00

In Stock

GLUD1 Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human, Monkey, Mouse, Pig, Gibbon, Horse, Orang-Utan (Predicted: Rat)
Conjugation Unconjugated
Immunogen GLUD1/Glutamate Dehydrogenase antibody was raised against synthetic peptide C-ESEEQKRNRVRGILR from an internal region of human GLUD1 (NP_005262.1; NP_036216.2). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Panda, Horse, Pig (100%); Rat, Opossum, Pufferfish (93%); Bovine, Xenopus, Stickleback (87%).
GLUD1 Rabbit Polyclonal Antibody
TA316790

USD 795.00

In Stock

GLUD1 Rabbit anti-Bovine Polyclonal Antibody

Applications IHC
Reactivities Bovine, Human
Conjugation Unconjugated
Immunogen GLUD1/Glutamate Dehydrogenase antibody was raised against bovine liver glutamate dehydrogenase.
CAD Rabbit Polyclonal Antibody
TA313543

USD 380.00

In Stock

Rabbit polyclonal CAD (Thr456) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CAD around the phosphorylation site of threonine 456 (P-I-TP-P-H).
Modifications Phospho-specific