Antibodies

View as table Download

Rabbit polyclonal anti-EPHB1/2/3 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHB1/2/3.

Rabbit polyclonal anti-NFAT4 (Ser165) antibody (Phospho-specific)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific phosphopeptide. The antibody against non-phosphopeptide was removed by chromatography using non-phosphopeptide corresponding to the phosphorylation site.
Modifications Phospho-specific

Rabbit Polyclonal Anti-NTN4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NTN4 antibody: synthetic peptide directed towards the N terminal of human NTN4. Synthetic peptide located within the following region: EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY

Rabbit polyclonal anti-EPHA6 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHA6.

Rabbit polyclonal NFATC4 Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NFATC4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 744-773 amino acids from the C-terminal region of human NFATC4.

Goat Anti-UNC5C Antibody

Applications IF
Reactivities Human, Mouse (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence NCTVSEEPTGID, from the internal region of the protein sequence according to NP_003719.2.

Rabbit polyclonal anti-DCC antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DCC.

Rabbit polyclonal anti-MET (met proto-oncogene) antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MET
Modifications Phospho-specific