Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
Applications | ELISA, FC, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
Conjugation | Biotin |
Immunogen | Collagen Type I from Human and Bovine placenta. |
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
Applications | ELISA, FC, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
Conjugation | Biotin |
Immunogen | Collagen Type I from Human and Bovine placenta. |
Rabbit Polyclonal Aggrecan Neoepitope Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
Applications | ELISA, FC, ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit Polyclonal Calnexin Antibody
Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643] |
Rabbit Polyclonal LRRK2 Antibody
Applications | FC, ICC/IF, IHC, IP, WB |
Reactivities | Bovine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A C-terminal synthetic peptide made to the human LRRK2 protein sequence (between residues 2500-2527). |
Rabbit Polyclonal Calreticulin Antibody
Applications | Block/Neutralize, Dot, Electron Microscopy, FC, ICC/IF, IHC, IP, Protein Array, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A fusion protein to mouse Calreticulin [UniProt# P14211] |
Rabbit Polyclonal PKM2 Antibody
Applications | FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the internal region of human PKM2 protein (within residues 350-450). [Swiss-Prot# P14618] |
Rabbit Polyclonal Perilipin Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Bovine, Human, Mouse, Porcine, Rat, Sheep |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a region between residues 450-522 (C-terminus) of the human perilipin protein. [Swiss-Prot# O60240] |
Rabbit Polyclonal LC3/MAP1LC3A Antibody
Applications | FC, ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Genomic sequence made to an N-terminal portion of the human LC3A protein [Swiss-Prot# Q9H492]. |
Rabbit Polyclonal MUC-1 Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal SR-BI Antibody
Applications | Block/Neutralize, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Hamster, Mustelid |
Conjugation | Unconjugated |
Immunogen | A C-terminal peptide containing residues from mouse SR-BI (within residues 450-509). [UniProt# Q61009] |
Rabbit polyclonal ENOA Antibody (N-term)
Applications | FC, IF, WB |
Reactivities | Human, Mouse (Predicted: Bovine, Monkey) |
Conjugation | Unconjugated |
Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
ARV1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Bovine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 23-51 amino acids from the N-terminal region of human ARV1. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
Applications | FC, IF, WB |
Reactivities | Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit polyclonal LMO4 Antibody (Center)
Applications | FC, IF, WB |
Reactivities | Human, Mouse (Predicted: Bovine) |
Conjugation | Unconjugated |
Immunogen | This LMO4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 104-131 amino acids from the Central region of human LMO4. |