Antibodies

Jump to Filters
View as table Download
p53 (TP53) Mouse Monoclonal Antibody [Clone ID: Pab 240]
TA336582

USD 550.00

5 Days

Mouse Monoclonal p53 Antibody (PAb 240)

Applications CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Yeast (Does not react with: Xenopus)
Conjugation Unconjugated
HDAC2 Rabbit Polyclonal Antibody
TA590734

USD 482.00

In Stock

Rabbit Polyclonal HDAC2 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
p53 (TP53) Rabbit Polyclonal Antibody
TA329146

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
p53 (TP53) Rabbit Polyclonal Antibody
TA329142

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP
PPAR gamma (PPARG) Rabbit Polyclonal Antibody
TA347270

USD 580.00

5 Days

Rabbit Polyclonal PPARG Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARG antibody: human PPARG (peroxisome proliferator-activated receptor gamma), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein.
SP1 Rabbit Polyclonal Antibody
AP06584PU-N

USD 465.00

3 Weeks

SP1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 421-470 of Human Sp1.
p53 (TP53) (Wild type + Mutant) (20-31) Mouse Monoclonal Antibody [Clone ID: Bp53-11]
AM09102PU-N

USD 425.00

2 Weeks

p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
EP300 Rabbit Polyclonal Antibody
R1015

USD 780.00

3 Days

EP300 rabbit polyclonal antibody, Supernatant

Applications ELISA, EMSA, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen P300 peptide corresponding to a region near the N-terminus of the Human protein conjugated to KLH.
CREB1 pSer133 Mouse Monoclonal Antibody [Clone ID: A3A4]
AM09297PU-N

USD 705.00

2 Weeks

CREB1 pSer133 mouse monoclonal antibody, clone A3A4, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated
CREB1 pSer133 Mouse Monoclonal Antibody [Clone ID: B1C4]
AM09298PU-N

USD 705.00

2 Weeks

CREB1 pSer133 mouse monoclonal antibody, clone B1C4, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated