Antibodies

Jump to Filters
View as table Download
AKT2 Rabbit Polyclonal Antibody
TA590729

USD 482.00

In Stock

Rabbit Polyclonal AKT2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
c-Jun (JUN) Rabbit Polyclonal Antibody
TA590119

USD 482.00

In Stock

Rabbit Polyclonal c-jun Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
c Fos (FOS) Rabbit Polyclonal Antibody
TA590201

USD 482.00

In Stock

Rabbit Polyclonal c-Fos Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
ELK1 Rabbit Polyclonal Antibody
TA590610

USD 482.00

In Stock

Rabbit Polyclonal ELK1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
Neurofibromin (NF1) Rabbit Polyclonal Antibody
AP31762PU-N

USD 535.00

2 Weeks

Neurofibromin (NF1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide from Human NF1.
Epitope: Internal.
TNFRSF1A Rabbit Polyclonal Antibody
TA328458

USD 314.00

In Stock

Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human sTNF Receptor Type I
ASK1 (MAP3K5) Rabbit Polyclonal Antibody
TA305959

USD 570.00

5 Days

Rabbit Polyclonal ASK1 Antibody

Applications ELISA, ICC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ASK1 antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human ASK1 This sequence is different from that of mouse by last two amino acids.
p53 (TP53) Rabbit Polyclonal Antibody
TA329146

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
NRAS Rabbit Polyclonal Antibody
TA590133

USD 482.00

In Stock

Rabbit Polyclonal NRAS Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
p53 (TP53) Rabbit Polyclonal Antibody
TA329142

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP
CACNB2 Rabbit Polyclonal Antibody
TA590334

USD 482.00

In Stock

Rabbit Polyclonal CACNB2 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
CD95 (FAS) Rabbit Polyclonal Antibody
TA590390

USD 482.00

In Stock

Rabbit Polyclonal Fas Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
TAOK1 (C-term) Rabbit Polyclonal Antibody
AP20077PU-N

USD 515.00

2 Weeks

TAOK1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human, Rat, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Xenopus
Conjugation Unconjugated
Immunogen TAOK1 antibody was raised against synthetic 17 amino acid peptide from C-Terminus of human TAOK1.
FGFR2 Rabbit Polyclonal Antibody
TA590009

USD 482.00

In Stock

Rabbit Polyclonal FGFR2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
Fas Ligand (FASLG) Rabbit Polyclonal Antibody
TA590044

USD 482.00

In Stock

Rabbit Polyclonal Fas Ligand Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.