Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Mouse Monoclonal Fibronectin/Anastellin Antibody (2F4)
| Applications | ELISA, FC, ICC/IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TA336913 is a replacement of AM06754SU-N.
Mouse Monoclonal iNOS Antibody (4E5)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
TA336918 is a replacement of AM06772PU-N.
Rabbit Polyclonal c-Myc Antibody
| Applications | ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106] |
Collagen IV (COL4A1) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Feline, Fish, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Human placental type IV Collagen. |
AKT1 (C-term) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
Mouse Monoclonal eNOS Antibody (6H2)
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TA336799 is a replacement of AM06374SU-N.
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Active filters
Category
- Antibodies
Reactivities
- Human
Applications
- ELISA
Conjugates
- Unconjugated
Pathways
- Small cell lung cancer
Filter by
Target Symbol
Antibody Hosts
Clonalities
Assay Types
Assay Platforms
Families
- Druggable Genome (49)
- ES Cell Differentiation/IPS (21)
- Stem cell - Pluripotency (15)
- Transcription Factors (13)
- Secreted Protein (12)
- Protein Kinase (11)
- Stem cell relevant signaling - JAK/STAT signaling pathway (8)
- Embryonic stem cells (7)
- Induced pluripotent stem cells (7)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (7)
- Stem cell relevant signaling - Wnt Signaling pathway (7)
- Transmembrane (5)