Antibodies

Jump to Filters
View as table Download
ZFYVE19 Rabbit Polyclonal Antibody
TA315945

USD 380.00

In Stock

Rabbit polyclonal anti-ZFYVE19 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZFYVE19.
ZFYVE19 (C-term) Rabbit Polyclonal Antibody
AP54652PU-N

USD 580.00

2 Weeks

ZFYVE19 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 386-415 amino acids from the C-terminal region of human ZFYVE19
ZFYVE19 Rabbit Polyclonal Antibody
TA339668

USD 539.00

5 Days

Rabbit Polyclonal Anti-ZFYVE19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZFYVE19 antibody: synthetic peptide directed towards the C terminal of human ZFYVE19. Synthetic peptide located within the following region: CNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH