Antibodies

Jump to Filters
View as table Download
SEMA4A Rabbit Polyclonal Antibody
TA381347

USD 365.00

3 Weeks

SEMA4A Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 320-580 of human SEMA4A (NP_071762.2).
SEMA4A Rabbit Polyclonal Antibody
AP20459PU-N

USD 465.00

3 Weeks

SEMA4A rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SEMA4A Rabbit Polyclonal Antibody
TA350396

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-SEMA4A rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SEMA4A
SEMA4A Rabbit Polyclonal Antibody
TA365006

USD 380.00

4 Weeks

SEMA4A rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SEMA4A
SEMA4A (N-term) Rabbit Polyclonal Antibody
AP53846PU-N

USD 580.00

2 Weeks

SEMA4A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 150-180 amino acids from the N-terminal region of Human SEMA4A
SEMA4A Rabbit Polyclonal Antibody
TA331773

USD 485.00

5 Days

Rabbit Polyclonal Anti-SEMA4A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SEMA4A Antibody: synthetic peptide directed towards the N terminal of human SEMA4A. Synthetic peptide located within the following region: PSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFL