Rabbit Polyclonal Anti-RNF113A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RNF113A Antibody is: synthetic peptide directed towards the N-terminal region of Human RNF113A. Synthetic peptide located within the following region: VVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKS |
Rabbit Polyclonal Anti-RNF113A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF113A antibody: synthetic peptide directed towards the middle region of human RNF113A. Synthetic peptide located within the following region: LQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPD |
Germany
Japan
United Kingdom
China