Rabbit monoclonal anti-NNMT antibody for SISCAPA, clone OTIR1F6
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-NNMT antibody for SISCAPA, clone OTIR1F6
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NNMT rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NNMT |
NNMT Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human NNMT (NP_006160.1). |
Modifications | Unmodified |
Rabbit Polyclonal Antibody against NNMT (Center)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NNMT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 77-106 amino acids from the Central region of human NNMT. |
Rabbit Polyclonal Anti-NNMT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NNMT antibody: synthetic peptide directed towards the N terminal of human NNMT. Synthetic peptide located within the following region: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC |
NNMT rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NNMT |
NNMT Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human NNMT (NP_006160.1). |
Modifications | Unmodified |
NNMT Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human NNMT (NP_006160.1). |
Modifications | Unmodified |