Antibodies

Jump to Filters
View as table Download
RIP (RIPK1) Rabbit Polyclonal Antibody
TA306838

USD 570.00

2 Weeks

Rabbit Polyclonal RIPK1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen RIPK1 antibody was raised against a 15 amino acid peptide from near the amino terminus of human RIPK1.
RIP (RIPK1) Rabbit Polyclonal Antibody
TA330334

USD 539.00

5 Days

Rabbit Polyclonal Anti-RIPK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RIPK1 antibody: synthetic peptide directed towards the middle region of human RIPK1. Synthetic peptide located within the following region: RRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQ
RIP (RIPK1) Rabbit Polyclonal Antibody
TA319759

USD 570.00

5 Days

Rabbit Polyclonal RIP1 Antibody

Applications E, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen RIP1 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human RIP1.