Antibodies

Jump to Filters
View as table Download
Placental lactogen (CSH1) Rabbit Polyclonal Antibody
TA350056

USD 380.00

In Stock

Rabbit Polyclonal Anti-CSH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CSH1
Placental lactogen (CSH1) (C-term) Rabbit Polyclonal Antibody
AP51099PU-N

USD 580.00

2 Weeks

Placental lactogen (CSH1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 180-208 amino acids from the C-terminal region of human CSH1
Placental lactogen (CSH1) Rabbit Polyclonal Antibody
TA345768

USD 485.00

5 Days

Rabbit Polyclonal Anti-CSH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSH1 antibody: synthetic peptide directed towards the middle region of human CSH1. Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS
Placental lactogen (CSH1) Rabbit Polyclonal Antibody
TA327692

USD 555.00

5 Days

Rabbit Polyclonal hPL Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated