Antibodies

Jump to Filters
View as table Download
MLH1 Rabbit Polyclonal Antibody
TA349405

USD 380.00

In Stock

Rabbit Polyclonal Anti-MLH1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MLH1
MLH1 Rabbit Polyclonal Antibody
TA335134

USD 539.00

5 Days

Rabbit polyclonal Anti-MLH1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MLH1 antibody: synthetic peptide directed towards the N terminal of human MLH1. Synthetic peptide located within the following region: MIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK
MLH1 Rabbit Polyclonal Antibody
AP20490PU-N

USD 465.00

3 Weeks

MLH1 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 450-500 of Human MLH1.
MLH1 Rabbit Polyclonal Antibody
TA311753

USD 380.00

In Stock

Rabbit polyclonal anti-MLH1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MLH1.