Antibodies

Jump to Filters
View as table Download
NNMT Rabbit Monoclonal Antibody [Clone ID: OTIR1F6]
TA591036

USD 516.00

In Stock

Rabbit monoclonal anti-NNMT antibody for SISCAPA, clone OTIR1F6

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NNMT Rabbit Polyclonal Antibody
TA346428

USD 485.00

5 Days

Rabbit Polyclonal Anti-NNMT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NNMT antibody: synthetic peptide directed towards the N terminal of human NNMT. Synthetic peptide located within the following region: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC