Rabbit Polyclonal Anti-ST6GALNAC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ST6GALNAC6 antibody: synthetic peptide directed towards the C terminal of human ST6GALNAC6. Synthetic peptide located within the following region: YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP |
Rabbit Polyclonal Anti-ST6GALNAC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ST6GALNAC6 antibody: synthetic peptide directed towards the N terminal of human ST6GALNAC6. Synthetic peptide located within the following region: ALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKT |
Germany
Japan
United Kingdom
China