Anti-SV2A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 21-35 amino acids of human synaptic vesicle glycoprotein 2A |
Anti-SV2A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 21-35 amino acids of human synaptic vesicle glycoprotein 2A |
Anti-FN1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 32-280 amino acids of human fibronectin 1 |
Anti-FN1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 32-280 amino acids of human fibronectin 1 |
Rabbit Polyclonal Anti-COMP Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human COMP |
Rabbit polyclonal anti-LAMC1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMC1. |
Laminin gamma 1 (LAMC1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti Osteopontin(SPP1) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Rat, Mouse, Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the internal portion of Osteopontin protein sequence. This sequence is identical to human, rat and mouse origins. |
Rabbit polyclonal Osteopontin antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human osteopontin . |
Rabbit anti Tenascin C Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Mouse, Rat, Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the internal segment of Tenascin C protein. This sequence is identical among human, rat and mouse. |
Rabbit polyclonal anti-LAMB2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMB2. |
SPP1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SPP1 |
Rabbit anti-COMP Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human COMP |
Rabbit Polyclonal Anti-Fibronectin 1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Fibronectin 1 Antibody: A synthesized peptide derived from human Fibronectin 1 |
Rabbit Polyclonal Anti-Vtn Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Vtn antibody is: synthetic peptide directed towards the middle region of Rat Vtn. Synthetic peptide located within the following region: EELCSGKPFDAFTDLKNGSLFAFRGEYCYELDETAVRPGYPKLIQDVWGI |
Rabbit Polyclonal Anti-Osteopontin Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Osteopontin Antibody: A synthesized peptide derived from human Osteopontin |