Antibodies

Jump to Filters
View as table Download
TNF alpha (TNF) Rabbit Polyclonal Antibody
AP20373PU-N

USD 465.00

3 Weeks

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA329505

USD 485.00

5 Days

Rabbit Polyclonal anti-GNAS antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody
TA313319

USD 380.00

4 Weeks

Rabbit polyclonal anti-TGF Beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β1 antibody.
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA329504

USD 539.00

5 Days

Rabbit Polyclonal anti-GNAS antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA336738

USD 605.00

5 Days

Rabbit Polyclonal TNF-alpha Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA308888

USD 625.00

5 Days

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Dog, Pig, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2)
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA323637

USD 380.00

In Stock

Anti-GNAS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA323618

USD 380.00

In Stock

Anti-TNF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor
TGF beta 2 (TGFB2) Rabbit Polyclonal Antibody
TA351797

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-TGFB2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TGFB2
TGF beta 1 (TGFB1) (N-term) Rabbit Polyclonal Antibody
AP54230PU-N

USD 580.00

2 Weeks

TGF beta 1 (TGFB1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 22-50 amino acids from the N-terminal region of Human TGFB1.
IGF1 Rabbit Polyclonal Antibody
PP1020P2

USD 465.00

2 Weeks

IGF1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) recombinant hIGF-1 (human Insulin Like Growth Factor-1)
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA308889

USD 535.00

In Stock

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Dog, Pig, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 716 and 998 of GNAS (Uniprot ID#Q5JWF2)
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA313322

USD 380.00

In Stock

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.
TGF beta 2 (TGFB2) Rabbit Polyclonal Antibody
TA356540

USD 539.00

5 Days

TGFB2 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TGFB2
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA323636

USD 380.00

2 Weeks

Anti-GNAS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus