Germany
Japan
United Kingdom
China
AMH Rabbit monoclonal antibody, clone OTIR1A3
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
AMH Rabbit monoclonal antibody, clone OTIR2H6
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
AMH Rabbit monoclonal antibody, clone OTIR5B9
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-AMH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
Rabbit anti-AMH polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
AMH Rabbit monoclonal antibody, clone OTIR1B8
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMH Rabbit monoclonal antibody, clone OTIR1F8
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMH Rabbit monoclonal antibody, clone OTIR5C9
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMH Rabbit monoclonal antibody, clone OTIR1E3
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMH Rabbit monoclonal antibody, clone OTIR2G3
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMH Rabbit monoclonal antibody, clone OTIR3B3
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMH Rabbit monoclonal antibody, clone OTIR3G5
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMH Rabbit monoclonal antibody, clone OTIR4F7
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMH Rabbit monoclonal antibody, clone OTIR4G8
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- AMH
Reactivities
- Human
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Secreted Protein