Rabbit polyclonal Anti-FYN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FYN antibody: synthetic peptide directed towards the N terminal of human FYN. Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN |
Rabbit polyclonal FYN Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human (Predicted: Bovine, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This FYN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human FYN. |
Rabbit polyclonal Fyn (Phospho-Tyr530) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Fyn around the phosphorylation site of tyrosine 530 (P-Q-YP-Q-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Fyn (Tyr530) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Fyn around the phosphorylation site of Tyrosine 530 |
| Modifications | Phospho-specific |
Rabbit Polyclonal c-Abl Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Abl |
Rabbit Polyclonal Abl (Tyr204) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Abl around the phosphorylation site of Tyrosine 204 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Abl (Tyr393/412) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Abl around the phosphorylation site of Tyrosine 393/412 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Abl (Tyr412) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Abl around the phosphorylation site of Tyrosine 412 |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
