Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 38 results

Page 1 of 3

(reset)

Dopamine D2 Receptor (DRD2) Rabbit Polyclonal Antibody

TA316680

USD 515.00

5 Days

Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications	IHC
Reactivities	Chimpanzee, Gorilla, Human (Predicted: Monkey, Rabbit)
Conjugation	Unconjugated
Immunogen	DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%).

HTR2C Rabbit Polyclonal Antibody

TA330447

USD 485.00

5 Days

Rabbit Polyclonal Anti-HTR2C Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-HTR2C antibody: synthetic peptide directed towards the N terminal of human HTR2C. Synthetic peptide located within the following region: SPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMA

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody

TA341637

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications	WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Metabotropic Glutamate Receptor 1 (GRM1) Rabbit Polyclonal Antibody

TA321217

USD 380.00

4 Weeks

Anti-GRM1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 31-44 amino acids of Human glutamate receptor, metabotropic 1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Dopamine Receptor D1 (DRD1) Rabbit Polyclonal Antibody

TA321199

USD 380.00

4 Weeks

Anti-DRD1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 10-23 amino acids of Human Dopamine receptor D1

1 / 3

2 / 3

3 / 3

Previous Next

5 HT 2A (HTR2A) Rabbit Polyclonal Antibody

RA24288-100

USD 805.00

2 Weeks

5 HT 2A (HTR2A) rabbit polyclonal antibody

Applications	IF, IHC, WB
Reactivities	Mouse, Rat
Conjugation	Unconjugated

Metabotropic Glutamate Receptor 1 (GRM1) Rabbit Polyclonal Antibody

TA321218

USD 380.00

In Stock

Anti-GRM1 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 31-44 amino acids of Human glutamate receptor, metabotropic 1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Dopamine D2 Receptor (DRD2) (Short Isoform, 239-246) Rabbit Polyclonal Antibody

BP122S

USD 925.00

2 Weeks

Dopamine D2 Receptor (DRD2) (Short Isoform, 239-246) rabbit polyclonal antibody, Serum

Applications	ELISA, IF, IHC, WB
Reactivities	Rat
Conjugation	Unconjugated
Immunogen	D2s (Ac239-Cys247) covalently attached to a carrier protein

EDG2 (LPAR1) Rabbit Polyclonal Antibody

TA311880

USD 380.00

4 Weeks

Rabbit polyclonal anti-EDG2 / LPAR1 antibody

Applications	IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human EDG2.
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

5 HT 2A (HTR2A) Rabbit Polyclonal Antibody

24288

USD 690.00

3 Days

5 HT 2A (HTR2A) rabbit polyclonal antibody

Applications	IF, IHC
Reactivities	Mouse, Rabbit, Rat
Conjugation	Unconjugated
Immunogen	Multiple antigenic peptide (MAP) of an N-terminal synthetic sequence corresponding to amino acids (22–41) of rat 5HT2A receptor.

EDG2 (LPAR1) Rabbit Polyclonal Antibody

TA350844

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-LPAR1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human LPAR1

1 / 3

2 / 3

3 / 3

Previous Next

HTR2C Rabbit Polyclonal Antibody

TA313299

USD 380.00

In Stock

Rabbit polyclonal anti-5-HT-2C antibody

Applications	IF, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human 5-HT-2C.

1 / 2

2 / 2

Previous Next

beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody

TA329147

USD 485.00

In Stock

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV

HTR2C Rabbit Polyclonal Antibody

AP01291PU-N

USD 465.00

3 Weeks

HTR2C rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide, corresponding to amino acids 400-450 of Human SR-2C.

Dopamine D2 Receptor (DRD2) (C-term) Rabbit Polyclonal Antibody

AP51318PU-N

USD 580.00

2 Weeks

Dopamine D2 Receptor (DRD2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	KLH conjugated synthetic peptide between 306-336 amino acids from the C-terminal region of Human Dopamine D2 receptor.

1 - 15 of 38 results

Page 1 of 3