Germany
Japan
United Kingdom
China
Antibodies
View as table Download
TNFRSF1A pSer274 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S274 of human TNFR. |
Rabbit Polyclonal Anti-TNFRSF1A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI |
Rabbit polyclonal TNF Receptor-1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TNF receptor-1. |
Tnfrsf1a rabbit polyclonal antibody, Purified
| Applications | ELISA, FN, IP, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
TNFRSF1A rabbit polyclonal antibody, Purified
| Applications | ELISA, FC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNFRSF1A rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Human sTNFRp55 expressed in Chinese Hamster Cells. |
TNFRSF1A rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant human sTNFRp55 expressed in Chinese Hamster Cells. |
TNFRSF1A rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Highly purified (>98%) recombinant human soluble TNF Receptor I (hs-TNF Receptor-I |
TNFRSF1A rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Highly purified (>98%) recombinant human soluble TNF Receptor I (hs-TNF Receptor-I |
Active filters
Target Symbol
- TNFRSF1A
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated