Antibodies

Jump to Filters
View as table Download
A4GALT Rabbit Polyclonal Antibody
TA350957

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-A4GALT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human A4GALT
A4GALT Rabbit Polyclonal Antibody
TA342029

USD 539.00

5 Days

Rabbit Polyclonal Anti-A4GALT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-A4GALT antibody: synthetic peptide directed towards the middle region of human A4GALT. Synthetic peptide located within the following region: RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHE
A4GALT Rabbit Polyclonal Antibody
TA342030

USD 539.00

5 Days

Rabbit Polyclonal Anti-A4GALT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-A4GALT antibody: synthetic peptide directed towards the middle region of human A4GALT. Synthetic peptide located within the following region: VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSI
A4GALT (N-term) Rabbit Polyclonal Antibody
AP50008PU-N

USD 580.00

2 Weeks

A4GALT (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 33-62 amino acids from the N-terminal region of human A4GALT